SCOP 1.65: Domain d1fvud_: 1fvu D:

Lineage for d1fvud_ (1fvu D:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Snake coagglutinin beta chain [88867] (5 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (2 PDB entries)

8. Domain d1fvud_: 1fvu D: [42348]
   Other proteins in same PDB: d1fvua_, d1fvuc_
   complexed with mg

Details for d1fvud_

PDB Entry: 1fvu, 1.8 Å

PDB Description: crystal structure of botrocetin

SCOP Domain Sequences for d1fvud_:

Sequence, based on SEQRES records:

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records):

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
a

Timeline for d1fvud_:

• d1fvud_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvud_ appears in SCOP 1.63
  
• d1fvud_ appears in SCOP 1.67
  
• d1fvud_ appears in the current release, SCOPe 2.08