Lineage for d1fvuc_ (1fvu C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607593Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607610Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)
  8. 2607612Domain d1fvuc_: 1fvu C: [42347]
    Other proteins in same PDB: d1fvub_, d1fvud_
    complexed with mg

Details for d1fvuc_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin
PDB Compounds: (C:) botrocetin alpha chain

SCOPe Domain Sequences for d1fvuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvuc_ d.169.1.1 (C:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOPe Domain Coordinates for d1fvuc_:

Click to download the PDB-style file with coordinates for d1fvuc_.
(The format of our PDB-style files is described here.)

Timeline for d1fvuc_: