SCOP 1.75: Domain d1fvub_: 1fvu B:

Lineage for d1fvub_ (1fvu B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)

8. Domain d1fvub_: 1fvu B: [42346]
   Other proteins in same PDB: d1fvua_, d1fvuc_

Details for d1fvub_

PDB Entry: 1fvu, 1.8 Å

PDB Description: crystal structure of botrocetin

PDB Compounds: (B:) botrocetin beta chain

SCOP Domain Sequences for d1fvub_:

Sequence, based on SEQRES records:

>d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records):

>d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
a

Timeline for d1fvub_:

• d1fvub_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvub_ appears in SCOP 1.73
  
• d1fvub_ appears in SCOPe 2.01
  
• d1fvub_ appears in the current release, SCOPe 2.08