SCOPe 2.05: Domain d1fvua_: 1fvu A:

Lineage for d1fvua_ (1fvu A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)

8. Domain d1fvua_: 1fvu A: [42345]
   Other proteins in same PDB: d1fvub_, d1fvud_
   complexed with mg

Details for d1fvua_

PDB Entry: 1fvu, 1.8 Å

PDB Description: crystal structure of botrocetin

PDB Compounds: (A:) botrocetin alpha chain

SCOPe Domain Sequences for d1fvua_:

Sequence; same for both SEQRES and ATOM records:

>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

Timeline for d1fvua_:

• d1fvua_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvua_ appears in SCOPe 2.04
  
• d1fvua_ appears in SCOPe 2.06
  
• d1fvua_ appears in the current release, SCOPe 2.08