Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (22 proteins) |
Protein Snake coagglutinin alpha chain [88861] (9 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (2 PDB entries) |
Domain d1fvua_: 1fvu A: [42345] Other proteins in same PDB: d1fvub_, d1fvud_ |
PDB Entry: 1fvu (more details), 1.8 Å
SCOP Domain Sequences for d1fvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin} dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc aqknpfvcksppp
Timeline for d1fvua_: