Lineage for d1fvua_ (1fvu A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264649Protein Snake coagglutinin [56446] (5 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 264662Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [56449] (2 PDB entries)
  8. 264663Domain d1fvua_: 1fvu A: [42345]

Details for d1fvua_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin

SCOP Domain Sequences for d1fvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvua_ d.169.1.1 (A:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOP Domain Coordinates for d1fvua_:

Click to download the PDB-style file with coordinates for d1fvua_.
(The format of our PDB-style files is described here.)

Timeline for d1fvua_: