Lineage for d1c3aa_ (1c3a A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Snake coagglutinin [56446] (3 species) 
Species Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId:88087] [56448] (1 PDB entry) 
Domain d1c3aa_: 1c3a A: [42343]
Details for d1c3aa_
PDB Entry: 1c3a (more details), 2.5 Å
PDB Description: crystal structure of flavocetin-a from the habu snake venom, a novel cyclic tetramer of c-type lectin-like heterodimers
SCOP Domain Sequences for d1c3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3aa_ d.169.1.1 (A:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis), flavocetin-A}
dfdcipgwsaydrycyqafskpknwedaesfceegvktshlvsiessgegdfvaqlvaek
iktsfqyvwiglriqnkeqqcrsewsdassvnyenlvkqfskkcyalkkgtelrtwfnvy
cgtenpevckytpec
SCOP Domain Coordinates for d1c3aa_:
Click to download the PDB-style file with coordinates for d1c3aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3aa_:
- d1c3aa_ appears in SCOP 1.57
- d1c3aa_ appears in the current release, SCOPe 2.08
View in 3D
