Lineage for d1ixxf_ (1ixx F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607635Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607636Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 2607643Domain d1ixxf_: 1ixx F: [42340]
    Other proteins in same PDB: d1ixxa_, d1ixxc_, d1ixxe_
    complexed with ca

Details for d1ixxf_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains
PDB Compounds: (F:) coagulation factors ix/x-binding protein

SCOPe Domain Sequences for d1ixxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxf_ d.169.1.1 (F:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOPe Domain Coordinates for d1ixxf_:

Click to download the PDB-style file with coordinates for d1ixxf_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxf_: