Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (5 families) |
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) |
Protein Snake coagglutinin [56446] (3 species) |
Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries) |
Domain d1ixxf_: 1ixx F: [42340] |
PDB Entry: 1ixx (more details), 2.5 Å
SCOP Domain Sequences for d1ixxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxf_ d.169.1.1 (F:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)} dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce fqa
Timeline for d1ixxf_: