SCOP 1.73: Domain d1ixxe_: 1ixx E:

Lineage for d1ixxe_ (1ixx E:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)

8. Domain d1ixxe_: 1ixx E: [42339]
   Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_
   complexed with ca

Details for d1ixxe_

PDB Entry: 1ixx, 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

PDB Compounds: (E:) coagulation factors ix/x-binding protein

SCOP Domain Sequences for d1ixxe_:

Sequence; same for both SEQRES and ATOM records:

>d1ixxe_ d.169.1.1 (E:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

Timeline for d1ixxe_:

• d1ixxe_ first appeared (with stable ids) in SCOP 1.55
  
• d1ixxe_ appears in SCOP 1.71
  
• d1ixxe_ appears in SCOP 1.75
  
• d1ixxe_ appears in the current release, SCOPe 2.08