![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
![]() | Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries) |
![]() | Domain d1ixxc_: 1ixx C: [42337] Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_ complexed with ca |
PDB Entry: 1ixx (more details), 2.5 Å
SCOPe Domain Sequences for d1ixxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxc_ d.169.1.1 (C:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg qqnpfvcea
Timeline for d1ixxc_: