Lineage for d1ixxb_ (1ixx B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139569Protein Snake coagglutinin [56446] (5 species)
  7. 139570Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries)
  8. 139572Domain d1ixxb_: 1ixx B: [42336]

Details for d1ixxb_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxb_ d.169.1.1 (B:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOP Domain Coordinates for d1ixxb_:

Click to download the PDB-style file with coordinates for d1ixxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxb_: