Lineage for d1ixxa_ (1ixx A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682376Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1682377Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)
  8. 1682382Domain d1ixxa_: 1ixx A: [42335]
    Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_
    complexed with ca

Details for d1ixxa_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains
PDB Compounds: (A:) coagulation factors ix/x-binding protein

SCOPe Domain Sequences for d1ixxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

SCOPe Domain Coordinates for d1ixxa_:

Click to download the PDB-style file with coordinates for d1ixxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxa_: