Lineage for d1ixxa_ (1ixx A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264649Protein Snake coagglutinin [56446] (5 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 264650Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries)
  8. 264651Domain d1ixxa_: 1ixx A: [42335]

Details for d1ixxa_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains

SCOP Domain Sequences for d1ixxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxa_ d.169.1.1 (A:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

SCOP Domain Coordinates for d1ixxa_:

Click to download the PDB-style file with coordinates for d1ixxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxa_: