| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (15 proteins) |
| Protein Snake coagglutinin [56446] (4 species) |
| Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries) |
| Domain d1ixxa_: 1ixx A: [42335] |
PDB Entry: 1ixx (more details), 2.5 Å
SCOP Domain Sequences for d1ixxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxa_ d.169.1.1 (A:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea
Timeline for d1ixxa_: