SCOPe 2.08: Domain d7apub1: 7apu B:1-121,B:157-214

Lineage for d7apub1 (7apu B:1-121,B:157-214)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Escherichia coli [TaxId:562] [52560] (10 PDB entries)
   contains a rudiment "zinc-finger" subdomain, residue 122-156

8. Domain d7apub1: 7apu B:1-121,B:157-214 [423336]
   Other proteins in same PDB: d7apua2, d7apub2
   automated match to d1akea1
   complexed with adp, na

Details for d7apub1

PDB Entry: 7apu, 1.36 Å

PDB Description: structure of adenylate kinase from escherichia coli in complex with two adp molecules refined at 1.36 a resolution.

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d7apub1:

Sequence; same for both SEQRES and ATOM records:

>d7apub1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d7apub1:

• d7apub1 is new in SCOPe 2.08-stable