SCOPe 2.07: Domain d1egga_: 1egg A:

Lineage for d1egga_ (1egg A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Macrophage mannose receptor, CRD4 [56444] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56445] (2 PDB entries)

8. Domain d1egga_: 1egg A: [42333]
   complexed with ca

Details for d1egga_

PDB Entry: 1egg, 2.3 Å

PDB Description: structure of a c-type carbohydrate-recognition domain (crd-4) from the macrophage mannose receptor

PDB Compounds: (A:) macrophage mannose receptor

SCOPe Domain Sequences for d1egga_:

Sequence, based on SEQRES records:

>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqiqk

Sequence, based on observed residues (ATOM records):

>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltyggftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndinc
ehlnnwicqiqk

Timeline for d1egga_:

• d1egga_ first appeared (with stable ids) in SCOP 1.55
  
• d1egga_ appears in SCOPe 2.06
  
• d1egga_ appears in the current release, SCOPe 2.08