Lineage for d1egga_ (1egg A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Macrophage mannose receptor, CRD4 [56444] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56445] (2 PDB entries) 
Domain d1egga_: 1egg A: [42333]
Details for d1egga_
PDB Entry: 1egg (more details), 2.3 Å
PDB Description: structure of a c-type carbohydrate-recognition domain (crd-4) from the macrophage mannose receptor
SCOP Domain Sequences for d1egga_:
Sequence, based on SEQRES records: (download)
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens)}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqiqk
Sequence, based on observed residues (ATOM records): (download)
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens)}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltyggftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndinc
ehlnnwicqiqk
SCOP Domain Coordinates for d1egga_:
Click to download the PDB-style file with coordinates for d1egga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egga_:
- d1egga_ appears in SCOP 1.57
- d1egga_ appears in the current release, SCOPe 2.08
View in 3D
