Lineage for d1egib_ (1egi B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. Protein Macrophage mannose receptor, CRD4 [56444] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56445] (2 PDB entries)
  8. Domain d1egib_: 1egi B: [42332]
    complexed with ca

Details for d1egib_

PDB Entry: 1egi (more details), 2.3 Å

PDB Description: structure of a c-type carbohydrate-recognition domain (crd-4) from the macrophage mannose receptor
PDB Compounds: (B:) macrophage mannose receptor

SCOPe Domain Sequences for d1egib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egib_ d.169.1.1 (B:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]}
ipkcpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrl
itasgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptm
swndincehlnnwicqiqkgqtp

SCOPe Domain Coordinates for d1egib_ are not available.

Timeline for d1egib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1egia_