Lineage for d1egia_ (1egi A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559057Protein Macrophage mannose receptor, CRD4 [56444] (1 species)
  7. 2559058Species Human (Homo sapiens) [TaxId:9606] [56445] (2 PDB entries)
  8. 2559059Domain d1egia_: 1egi A: [42331]
    complexed with ca

Details for d1egia_

PDB Entry: 1egi (more details), 2.3 Å

PDB Description: structure of a c-type carbohydrate-recognition domain (crd-4) from the macrophage mannose receptor
PDB Compounds: (A:) macrophage mannose receptor

SCOPe Domain Sequences for d1egia_:

Sequence, based on SEQRES records: (download)

>d1egia_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqiq

Sequence, based on observed residues (ATOM records): (download)

>d1egia_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasg
syhklfwlgltyggftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndinceh
lnnwicqiq

SCOPe Domain Coordinates for d1egia_:

Click to download the PDB-style file with coordinates for d1egia_.
(The format of our PDB-style files is described here.)

Timeline for d1egia_: