SCOPe 2.08: Domain d7zy4a_: 7zy4 A:

Lineage for d7zy4a_ (7zy4 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.7: HAT/Suf repeat [158782] (4 proteins)
   includes Pfam PF05843
   Pfam PF02184
   this is a repeat family; one repeat unit is 2ond A:372-408 found in domain

6. Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (2 species)

7. Species Homo sapiens [TaxId:9606] [423298] (1 PDB entry)

8. Domain d7zy4a_: 7zy4 A: [423302]
   automated match to d2onda1
   complexed with gol

Details for d7zy4a_

PDB Entry: 7zy4, 2.55 Å

PDB Description: crystal structure of human cstf77 in complex with hfip1

PDB Compounds: (A:) Cleavage stimulation factor subunit 3

SCOPe Domain Sequences for d7zy4a_:

Sequence; same for both SEQRES and ATOM records:

>d7zy4a_ a.118.8.7 (A:) Cleavage stimulation factor 77 kDa subunit CSTF3 {Homo sapiens [TaxId: 9606]}
qeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyleq
sskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhsiy
nrllaiedidptlvyiqymkfarraegiksgrmifkkaredtrtrhhvyvtaalmeyycs
kdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeksge
iwarflafesnigdlasilkvekrrftafkeeyegketallvdrykfmdlypcsaselka
lgykd

Timeline for d7zy4a_:

• d7zy4a_ is new in SCOPe 2.08-stable