Lineage for d7zy4b_ (7zy4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726917Family a.118.8.7: HAT/Suf repeat [158782] (4 proteins)
    includes Pfam PF05843
    Pfam PF02184

    this is a repeat family; one repeat unit is 2ond A:372-408 found in domain
  6. 2726918Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (2 species)
  7. 3086981Species Homo sapiens [TaxId:9606] [423298] (1 PDB entry)
  8. 3086982Domain d7zy4b_: 7zy4 B: [423299]
    automated match to d2onda1
    complexed with gol

Details for d7zy4b_

PDB Entry: 7zy4 (more details), 2.55 Å

PDB Description: crystal structure of human cstf77 in complex with hfip1
PDB Compounds: (B:) Cleavage stimulation factor subunit 3

SCOPe Domain Sequences for d7zy4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7zy4b_ a.118.8.7 (B:) Cleavage stimulation factor 77 kDa subunit CSTF3 {Homo sapiens [TaxId: 9606]}
pqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyle
qsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhsi
ynrllaiedidptlvyiqymkfarraegiksgrmifkkaredtrtrhhvyvtaalmeyyc
skdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeksg
eiwarflafesnigdlasilkvekrrftafkeeyegketallvdrykfmdlypcsaselk
algykd

SCOPe Domain Coordinates for d7zy4b_:

Click to download the PDB-style file with coordinates for d7zy4b_.
(The format of our PDB-style files is described here.)

Timeline for d7zy4b_:

  • d7zy4b_ is new in SCOPe 2.08-stable