Lineage for d7ukoh_ (7uko H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 3086897Domain d7ukoh_: 7uko H: [423214]
    Other proteins in same PDB: d7ukoa_, d7ukoc_, d7ukof_, d7ukol_
    automated match to d2vc2h_
    complexed with ca, cl, gol, mn, nag, so4, xqs

Details for d7ukoh_

PDB Entry: 7uko (more details), 2.6 Å

PDB Description: integrin alaphiibbeta3 complex with sibrafiban (mn)
PDB Compounds: (H:) 10e5 fab heavy chain

SCOPe Domain Sequences for d7ukoh_:

Sequence, based on SEQRES records: (download)

>d7ukoh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d7ukoh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvctgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d7ukoh_:

Click to download the PDB-style file with coordinates for d7ukoh_.
(The format of our PDB-style files is described here.)

Timeline for d7ukoh_:

  • d7ukoh_ is new in SCOPe 2.08-stable