Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
Domain d7utzz_: 7utz Z: [423211] Other proteins in same PDB: d7utza_, d7utzb_ automated match to d2trcg_ complexed with nag, z41 |
PDB Entry: 7utz (more details), 2.4 Å
SCOPe Domain Sequences for d7utzz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7utzz_ a.137.3.1 (Z:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfr
Timeline for d7utzz_: