Lineage for d7ue0h_ (7ue0 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 3086881Domain d7ue0h_: 7ue0 H: [423198]
    Other proteins in same PDB: d7ue0a_, d7ue0c_, d7ue0f_, d7ue0l_
    automated match to d2vc2h_
    complexed with ca, cl, gol, mg, mwx, nag, so4

Details for d7ue0h_

PDB Entry: 7ue0 (more details), 2.74 Å

PDB Description: integrin alaphiibbeta3 complex with fradafiban
PDB Compounds: (H:) 10e5 fab heavy chain

SCOPe Domain Sequences for d7ue0h_:

Sequence, based on SEQRES records: (download)

>d7ue0h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d7ue0h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvctgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d7ue0h_:

Click to download the PDB-style file with coordinates for d7ue0h_.
(The format of our PDB-style files is described here.)

Timeline for d7ue0h_:

  • d7ue0h_ is new in SCOPe 2.08-stable