Lineage for d7ts5c_ (7ts5 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004267Species Human (Homo sapiens) [TaxId:9606] [187302] (89 PDB entries)
  8. 3086853Domain d7ts5c_: 7ts5 C: [423170]
    Other proteins in same PDB: d7ts5b2
    automated match to d4ucha_
    complexed with gol, h4b, hem, k9c, zn; mutant

Details for d7ts5c_

PDB Entry: 7ts5 (more details), 1.84 Å

PDB Description: structure of human neuronal nitric oxide synthase r354a/g357d mutant heme domain in complex with 4-methyl-6-(3-(methylamino)prop-1-yn-1- yl)pyridin-2-amine
PDB Compounds: (C:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d7ts5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ts5c_ d.174.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfplak
efidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgri
qwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsql
iryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippe
lvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdyc
dnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfi
khmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

SCOPe Domain Coordinates for d7ts5c_:

Click to download the PDB-style file with coordinates for d7ts5c_.
(The format of our PDB-style files is described here.)

Timeline for d7ts5c_:

  • d7ts5c_ is new in SCOPe 2.08-stable