Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187302] (89 PDB entries) |
Domain d7ts5c_: 7ts5 C: [423170] Other proteins in same PDB: d7ts5b2 automated match to d4ucha_ complexed with gol, h4b, hem, k9c, zn; mutant |
PDB Entry: 7ts5 (more details), 1.84 Å
SCOPe Domain Sequences for d7ts5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ts5c_ d.174.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} flkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfplak efidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgri qwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsql iryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippe lvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdyc dnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfi khmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk
Timeline for d7ts5c_:
View in 3D Domains from other chains: (mouse over for more information) d7ts5a_, d7ts5b1, d7ts5b2, d7ts5d_ |