SCOPe 2.08: Domain d7p4bg2: 7p4b G:182-276

Lineage for d7p4bg2 (7p4b G:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7p4bg2: 7p4b G:182-276 [423145]
   Other proteins in same PDB: d7p4ba1, d7p4bb1, d7p4bb2, d7p4bc1, d7p4bd1, d7p4bd2, d7p4be1, d7p4bf1, d7p4bf2, d7p4bg1, d7p4bh1, d7p4bh2
   automated match to d6lt6a2
   complexed with gol, po4, so4, zn

Details for d7p4bg2

PDB Entry: 7p4b, 1.72 Å

PDB Description: hla-e*01:03 in complex with il9

PDB Compounds: (G:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d7p4bg2:

Sequence; same for both SEQRES and ATOM records:

>d7p4bg2 b.1.1.0 (G:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrwkp

Timeline for d7p4bg2:

• d7p4bg2 is new in SCOPe 2.08-stable