SCOPe 2.08: Domain d7leod_: 7leo D:

Lineage for d7leod_ (7leo D:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.0: automated matches [254207] (1 protein)
   not a true family

6. Protein automated matches [254456] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [254972] (3 PDB entries)

8. Domain d7leod_: 7leo D: [423088]
   automated match to d1tbna_
   complexed with xp5, xzj, zn

Details for d7leod_

PDB Entry: 7leo, 1.65 Å

PDB Description: c1b domain of protein kinase c in complex with diacylglycerol-lactone (ajh-836) and 1,2-diheptanoyl-sn-glycero-3-phosphocholine

PDB Compounds: (D:) protein kinase c delta type

SCOPe Domain Sequences for d7leod_:

Sequence; same for both SEQRES and ATOM records:

>d7leod_ g.49.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

Timeline for d7leod_:

• d7leod_ is new in SCOPe 2.08-stable