Lineage for d7leoa_ (7leo A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037854Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 3037855Protein automated matches [254456] (2 species)
    not a true protein
  7. 3037860Species Norway rat (Rattus norvegicus) [TaxId:10116] [254972] (3 PDB entries)
  8. 3086770Domain d7leoa_: 7leo A: [423087]
    automated match to d1tbna_
    complexed with xp5, xzj, zn

Details for d7leoa_

PDB Entry: 7leo (more details), 1.65 Å

PDB Description: c1b domain of protein kinase c in complex with diacylglycerol-lactone (ajh-836) and 1,2-diheptanoyl-sn-glycero-3-phosphocholine
PDB Compounds: (A:) protein kinase c delta type

SCOPe Domain Sequences for d7leoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7leoa_ g.49.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mphrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

SCOPe Domain Coordinates for d7leoa_:

Click to download the PDB-style file with coordinates for d7leoa_.
(The format of our PDB-style files is described here.)

Timeline for d7leoa_:

  • d7leoa_ is new in SCOPe 2.08-stable