Lineage for d2def__ (2def -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily) Superfamily d.167.1: Peptide deformylase [56420] (1 family) 
Family d.167.1.1: Peptide deformylase [56421] (1 protein) Protein Peptide deformylase [56422] (1 species) Species Escherichia coli [TaxId:562] [56423] (12 PDB entries) 
Domain d2def__: 2def - [42305]
Details for d2def__
PDB Entry: 2def (more details)
PDB Description: peptide deformylase catalytic core (residues 1-147), nmr, 20 structures
SCOP Domain Sequences for d2def__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2def__ d.167.1.1 (-) Peptide deformylase {Escherichia coli}
vlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivid
vsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfele
adgllaiciqhemdhlvgklfmdyls
SCOP Domain Coordinates for d2def__:
Click to download the PDB-style file with coordinates for d2def__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2def__:
- d2def__ appears in SCOP 1.57
- d2def__ appears in the current release, SCOPe 2.08, called d2defa_
View in 3D