Lineage for d1dff__ (1dff -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37264Fold d.167: Peptide deformylase [56419] (1 superfamily)
  4. 37265Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
  5. 37266Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 37267Protein Peptide deformylase [56422] (1 species)
  7. 37268Species Escherichia coli [TaxId:562] [56423] (12 PDB entries)
  8. 37292Domain d1dff__: 1dff - [42304]

Details for d1dff__

PDB Entry: 1dff (more details), 2.88 Å

PDB Description: peptide deformylase

SCOP Domain Sequences for d1dff__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dff__ d.167.1.1 (-) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

SCOP Domain Coordinates for d1dff__:

Click to download the PDB-style file with coordinates for d1dff__.
(The format of our PDB-style files is described here.)

Timeline for d1dff__: