Lineage for d1bsja_ (1bsj A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37264Fold d.167: Peptide deformylase [56419] (1 superfamily)
  4. 37265Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
  5. 37266Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 37267Protein Peptide deformylase [56422] (1 species)
  7. 37268Species Escherichia coli [TaxId:562] [56423] (12 PDB entries)
  8. 37290Domain d1bsja_: 1bsj A: [42302]

Details for d1bsja_

PDB Entry: 1bsj (more details), 3 Å

PDB Description: cobalt deformylase inhibitor complex from e.coli

SCOP Domain Sequences for d1bsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsja_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlka

SCOP Domain Coordinates for d1bsja_:

Click to download the PDB-style file with coordinates for d1bsja_.
(The format of our PDB-style files is described here.)

Timeline for d1bsja_: