Lineage for d1bsja_ (1bsj A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily) Superfamily d.167.1: Peptide deformylase [56420] (1 family) 
Family d.167.1.1: Peptide deformylase [56421] (1 protein) Protein Peptide deformylase [56422] (1 species) Species Escherichia coli [TaxId:562] [56423] (12 PDB entries) 
Domain d1bsja_: 1bsj A: [42302]
Details for d1bsja_
PDB Entry: 1bsj (more details), 3 Å
PDB Description: cobalt deformylase inhibitor complex from e.coli
SCOP Domain Sequences for d1bsja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsja_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlka
SCOP Domain Coordinates for d1bsja_:
Click to download the PDB-style file with coordinates for d1bsja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bsja_:
- d1bsja_ appears in SCOP 1.57
- d1bsja_ appears in the current release, SCOPe 2.08
View in 3D