![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein Peptide deformylase [56422] (11 species) |
![]() | Species Escherichia coli [TaxId:562] [56423] (21 PDB entries) |
![]() | Domain d1bs7b_: 1bs7 B: [42300] complexed with ni, so4 |
PDB Entry: 1bs7 (more details), 2.5 Å
SCOPe Domain Sequences for d1bs7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs7b_ d.167.1.1 (B:) Peptide deformylase {Escherichia coli [TaxId: 562]} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
Timeline for d1bs7b_: