Lineage for d7dtib_ (7dti B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803640Family b.55.1.9: TFIIH domain [110272] (3 proteins)
  6. 3086668Protein automated matches [422985] (1 species)
    not a true protein
  7. 3086669Species Homo sapiens [TaxId:9606] [422986] (1 PDB entry)
  8. 3086670Domain d7dtib_: 7dti B: [422987]
    automated match to d2rukb_
    protein/RNA complex

Details for d7dtib_

PDB Entry: 7dti (more details)

PDB Description: solution structure of the complex between rna polymerase subunit rpb6 and tfiih p62 ph domain
PDB Compounds: (B:) General transcription factor IIH subunit 1

SCOPe Domain Sequences for d7dtib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dtib_ b.55.1.9 (B:) automated matches {Homo sapiens [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d7dtib_:

Click to download the PDB-style file with coordinates for d7dtib_.
(The format of our PDB-style files is described here.)

Timeline for d7dtib_:

  • d7dtib_ is new in SCOPe 2.08-stable