Lineage for d8dpnb_ (8dpn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912508Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (4 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 3086663Species Azotobacter vinelandii [TaxId:322710] [422980] (1 PDB entry)
  8. 3086664Domain d8dpnb_: 8dpn B: [422981]
    Other proteins in same PDB: d8dpna_, d8dpnc_
    automated match to d6o7mb_
    complexed with clf, fe, hca, ics

Details for d8dpnb_

PDB Entry: 8dpn (more details), 2.49 Å

PDB Description: cryoem structure of azotobacter vinelandii nitrogenase mofep during catalytic n2 reduction
PDB Compounds: (B:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d8dpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8dpnb_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 322710]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d8dpnb_:

Click to download the PDB-style file with coordinates for d8dpnb_.
(The format of our PDB-style files is described here.)

Timeline for d8dpnb_:

  • d8dpnb_ is new in SCOPe 2.08-stable