SCOPe 2.06: Domain d1bs5b_: 1bs5 B:

Lineage for d1bs5b_ (1bs5 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Escherichia coli [TaxId:562] [56423] (21 PDB entries)

8. Domain d1bs5b_: 1bs5 B: [42297]
   complexed with so4, zn

Details for d1bs5b_

PDB Entry: 1bs5, 2.5 Å

PDB Description: peptide deformylase as zn2+ containing form

PDB Compounds: (B:) protein (peptide deformylase)

SCOPe Domain Sequences for d1bs5b_:

Sequence; same for both SEQRES and ATOM records:

>d1bs5b_ d.167.1.1 (B:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara

Timeline for d1bs5b_:

• d1bs5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bs5b_ appears in SCOPe 2.05
  
• d1bs5b_ appears in SCOPe 2.07
  
• d1bs5b_ appears in the current release, SCOPe 2.08