Lineage for d7ouva2 (7ouv A:102-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766305Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)
  8. 3086651Domain d7ouva2: 7ouv A:102-205 [422968]
    Other proteins in same PDB: d7ouva3
    automated match to d2eeda1
    mutant

Details for d7ouva2

PDB Entry: 7ouv (more details), 1.8 Å

PDB Description: crystal structure of human filamin c domains 14-15 cardiovascular disease causing mutation s1624l
PDB Compounds: (A:) Isoform 2 of Filamin-C

SCOPe Domain Sequences for d7ouva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ouva2 b.1.18.0 (A:102-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgdaskclvtvsigghglgaclgpriqigqetvitvdakaagegkvtctvstpdgaeldv
dvvenhdgtfdiyytapepgkyvitirfggehipnspfhvlate

SCOPe Domain Coordinates for d7ouva2:

Click to download the PDB-style file with coordinates for d7ouva2.
(The format of our PDB-style files is described here.)

Timeline for d7ouva2:

  • d7ouva2 is new in SCOPe 2.08-stable