SCOPe 2.08: Domain d7yy5a1: 7yy5 A:1-157

Lineage for d7yy5a1 (7yy5 A:1-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Mycobacteroides abscessus [TaxId:36809] [422913] (1 PDB entry)

8. Domain d7yy5a1: 7yy5 A:1-157 [422957]
   Other proteins in same PDB: d7yy5a2
   automated match to d5o08a_
   complexed with i7l

Details for d7yy5a1

PDB Entry: 7yy5, 1.5 Å

PDB Description: crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 9

PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d7yy5a1:

Sequence; same for both SEQRES and ATOM records:

>d7yy5a1 c.26.1.0 (A:1-157) automated matches {Mycobacteroides abscessus [TaxId: 36809]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
aysfvssslakevatyggdvsallpasvhqrllgklr

Timeline for d7yy5a1:

• d7yy5a1 is new in SCOPe 2.08-stable