SCOPe 2.08: Domain d7to6a_: 7to6 A:

Lineage for d7to6a_ (7to6 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d7to6a_: 7to6 A: [422911]
   automated match to d1fgcd_
   complexed with act, cl, g77, na

Details for d7to6a_

PDB Entry: 7to6, 1.21 Å

PDB Description: hiv-1 wild type protease with grl-01717a, with c-4 substituted cyclohexane-fused bis-tetrahydrofuran (chf-thf) derivatives as p2- ligand [diastereomer 2]

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d7to6a_:

Sequence; same for both SEQRES and ATOM records:

>d7to6a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d7to6a_:

• d7to6a_ is new in SCOPe 2.08-stable