![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
![]() | Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
![]() | Protein automated matches [190472] (8 species) not a true protein |
![]() | Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382213] (283 PDB entries) |
![]() | Domain d5sraa_: 5sra A: [422908] Other proteins in same PDB: d5srab2 automated match to d6z5ta_ complexed with r0l |
PDB Entry: 5sra (more details), 1.05 Å
SCOPe Domain Sequences for d5sraa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sraa_ c.50.1.2 (A:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} vnsfsgylkltdnvyiknadiveeakkvkptvvvnaanvylkhgggvagalnkatnnamq vesddyiatngplkvggscvlsghnlakhclhvvgpnvnkgediqllksayenfnqhevl lapllsagifgadpihslrvcvdtvrtnvylavfdknlydklvssfl
Timeline for d5sraa_: