Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Rhodococcus coprophilus [TaxId:38310] [422900] (1 PDB entry) |
Domain d7v44a_: 7v44 A: [422901] automated match to d1cpta_ complexed with c3u, gol, hem, po4 |
PDB Entry: 7v44 (more details), 1.42 Å
SCOPe Domain Sequences for d7v44a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7v44a_ a.104.1.0 (A:) automated matches {Rhodococcus coprophilus [TaxId: 38310]} taaipdeiarqivlpeghkdnvplfeayrwlrenqplgqarvegydplwlitkyadlmev erqpqifaagggedkgsnnpilanqagdeftrqllggnlrildalpyldqpehsvvkdva fdwfrpanlkkwedriretarasidrllaggpdldavqefavffplrvimslfgvpeede prmmaltqdffgvadpdaqrddiealspdaaaqqwaatiadfyayfdvlvesrraeprdd latliavakdengeyfpktfaygwfvaiataghdttastlagclqslaahpevldrvkgd pdlipdlvneslrivspvkhftrvalqdyemrgqkikagdrlmllfqsgnrdaevfdrpd dfdidrrpnkhiafgygphmcigqhlaklelkvmlqellphlervevsgepkliqtnfvg glrklpvhltfs
Timeline for d7v44a_: