Lineage for d1bs4a_ (1bs4 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85537Fold d.167: Peptide deformylase [56419] (1 superfamily)
  4. 85538Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
  5. 85539Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 85540Protein Peptide deformylase [56422] (1 species)
  7. 85541Species Escherichia coli [TaxId:562] [56423] (12 PDB entries)
  8. 85542Domain d1bs4a_: 1bs4 A: [42287]

Details for d1bs4a_

PDB Entry: 1bs4 (more details), 1.9 Å

PDB Description: peptide deformylase as zn2+ containing form (native) in complex with inhibitor polyethylene glycol

SCOP Domain Sequences for d1bs4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs4a_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara

SCOP Domain Coordinates for d1bs4a_:

Click to download the PDB-style file with coordinates for d1bs4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bs4a_: