Lineage for d7t5zb_ (7t5z B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814330Species Pseudomonas aeruginosa [TaxId:381754] [276926] (6 PDB entries)
  8. 3086544Domain d7t5zb_: 7t5z B: [422861]
    automated match to d6ueea_
    complexed with f6i, peg

Details for d7t5zb_

PDB Entry: 7t5z (more details), 2.25 Å

PDB Description: p. aeruginosa lpxa in complex with ligand l8
PDB Compounds: (B:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d7t5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7t5zb_ b.81.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
slidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqf
ssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahigh
dsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayv
tvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpe
vavfrdsiqsatrgitr

SCOPe Domain Coordinates for d7t5zb_:

Click to download the PDB-style file with coordinates for d7t5zb_.
(The format of our PDB-style files is described here.)

Timeline for d7t5zb_:

  • d7t5zb_ is new in SCOPe 2.08-stable