Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
Protein automated matches [254715] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [419966] (5 PDB entries) |
Domain d7puqc_: 7puq C: [422833] automated match to d2y1xa_ complexed with 867, edo |
PDB Entry: 7puq (more details), 2.09 Å
SCOPe Domain Sequences for d7puqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7puqc_ c.66.1.6 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
Timeline for d7puqc_: