Lineage for d1bszc_ (1bsz C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3000945Protein Peptide deformylase [56422] (11 species)
  7. 3000951Species Escherichia coli [TaxId:562] [56423] (21 PDB entries)
  8. 3000963Domain d1bszc_: 1bsz C: [42283]
    complexed with 2pe, fe, so4

Details for d1bszc_

PDB Entry: 1bsz (more details), 1.9 Å

PDB Description: peptide deformylase as fe2+ containing form (native) in complex with inhibitor polyethylene glycol
PDB Compounds: (C:) protein (peptide deformylase)

SCOPe Domain Sequences for d1bszc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bszc_ d.167.1.1 (C:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara

SCOPe Domain Coordinates for d1bszc_:

Click to download the PDB-style file with coordinates for d1bszc_.
(The format of our PDB-style files is described here.)

Timeline for d1bszc_: