SCOPe 2.08: Domain d7pphb2: 7pph B:164-483

Lineage for d7pphb2 (7pph B:164-483)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
   automatically mapped to Pfam PF04095

6. Protein automated matches [419237] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries)

8. Domain d7pphb2: 7pph B:164-483 [422815]
   Other proteins in same PDB: d7ppha1, d7pphb1
   automated match to d2e5da2
   complexed with 7ye, gol, po4

Details for d7pphb2

PDB Entry: 7pph, 1.74 Å

PDB Description: crystal structure of nampt in complex with compound 10

PDB Compounds: (B:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d7pphb2:

Sequence; same for both SEQRES and ATOM records:

>d7pphb2 c.1.17.2 (B:164-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy
vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk
ngkvtksysfdeirknaqln

Timeline for d7pphb2:

• d7pphb2 is new in SCOPe 2.08-stable