SCOPe 2.08: Domain d7ppta1: 7ppt A:1-143

Lineage for d7ppta1 (7ppt A:1-143)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Sulfurisphaera tokodaii [TaxId:273063] [422807] (1 PDB entry)

8. Domain d7ppta1: 7ppt A:1-143 [422808]
   Other proteins in same PDB: d7ppta2, d7pptb2
   automated match to d1j30a_
   complexed with cl, fe, oh, trs

Details for d7ppta1

PDB Entry: 7ppt, 1.42 Å

PDB Description: structure of dife-sulerythrin at 0.26 mgy total absorbed dose

PDB Compounds: (A:) Sulerythrin

SCOPe Domain Sequences for d7ppta1:

Sequence; same for both SEQRES and ATOM records:

>d7ppta1 a.25.1.1 (A:1-143) automated matches {Sulfurisphaera tokodaii [TaxId: 273063]}
mkdlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafgh
ldfirqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfe
tlaraekshaekfqnvlkqlkgg

Timeline for d7ppta1:

• d7ppta1 is new in SCOPe 2.08-stable