Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Sulfurisphaera tokodaii [TaxId:273063] [422807] (1 PDB entry) |
Domain d7ppta1: 7ppt A:1-143 [422808] Other proteins in same PDB: d7ppta2, d7pptb2 automated match to d1j30a_ complexed with cl, fe, oh, trs |
PDB Entry: 7ppt (more details), 1.42 Å
SCOPe Domain Sequences for d7ppta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ppta1 a.25.1.1 (A:1-143) automated matches {Sulfurisphaera tokodaii [TaxId: 273063]} mkdlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafgh ldfirqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfe tlaraekshaekfqnvlkqlkgg
Timeline for d7ppta1: