Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries) |
Domain d7ppaa_: 7ppa A: [422803] automated match to d2arpa_ complexed with gol |
PDB Entry: 7ppa (more details), 1.48 Å
SCOPe Domain Sequences for d7ppaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ppaa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nyckrtplyidfkeigwdswiiappgyeayecrgvcnyplaehltptkhaiiqalvhlkn sqkaskaccvptklepisilyldkgvvtykfkyegmavsecgcr
Timeline for d7ppaa_: