SCOPe 2.08: Domain d7ppaa_: 7ppa A:

Lineage for d7ppaa_ (7ppa A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)

8. Domain d7ppaa_: 7ppa A: [422803]
   automated match to d2arpa_
   complexed with gol

Details for d7ppaa_

PDB Entry: 7ppa, 1.48 Å

PDB Description: high resolution structure of bone morphogenetic protein receptor type ii (bmprii) extracellular domain in complex with bmp10

PDB Compounds: (A:) Bone morphogenetic protein 10

SCOPe Domain Sequences for d7ppaa_:

Sequence; same for both SEQRES and ATOM records:

>d7ppaa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nyckrtplyidfkeigwdswiiappgyeayecrgvcnyplaehltptkhaiiqalvhlkn
sqkaskaccvptklepisilyldkgvvtykfkyegmavsecgcr

Timeline for d7ppaa_:

• d7ppaa_ is new in SCOPe 2.08-stable