Lineage for d2pawa2 (2paw A:797-1009)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1442144Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 1442145Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 1442146Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 1442152Domain d2pawa2: 2paw A:797-1009 [42279]
    Other proteins in same PDB: d2pawa1

Details for d2pawa2

PDB Entry: 2paw (more details), 2.3 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase
PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d2pawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pawa2 d.166.1.2 (A:797-1009) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfny

SCOPe Domain Coordinates for d2pawa2:

Click to download the PDB-style file with coordinates for d2pawa2.
(The format of our PDB-style files is described here.)

Timeline for d2pawa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pawa1