Lineage for d1paxa2 (1pax A:797-1011)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1940098Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 1940099Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 1940100Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 1940104Domain d1paxa2: 1pax A:797-1011 [42278]
    Other proteins in same PDB: d1paxa1
    complexed with dhq

Details for d1paxa2

PDB Entry: 1pax (more details), 2.4 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 3,4-dihydro-5-methyl-isoquinolinone
PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d1paxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paxa2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

SCOPe Domain Coordinates for d1paxa2:

Click to download the PDB-style file with coordinates for d1paxa2.
(The format of our PDB-style files is described here.)

Timeline for d1paxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1paxa1